Ir al contenido
-
Ordenar por: Destacado
Custom peptide: Sequence MTELNKKLQNSLHGYDILDAQQLSEVDGGIAPLLIAGGIVLAGGGGFAAGYGLSRWLG, 5 MG
999,00 € 999.0 EUR
Custom Service size: TM1192 PriGrow X Media
500,00 € 500.0 EUR
Custom Rabbit antisize:Arabidopsis thaliana Mousesize:ear cress GAUT1 Polyclonal antibody size: 1 mL
2.035,00 € 2035.0 EUR
Custom RNA oligo synthesis size: 50 nmol scale
32,00 € 32.0 EUR
Custom DNA oligo 50 nmol scale synthesis x19
173,00 € 173.0 EUR
Custom Aliquot into 12 x 25 µL
36,81 € 36.81 EUR
Custom AAV with DNA amplification 10^11 GC/ml AAV1 size: standard aliquot 3 x 100ul
331,29 € 331.29 EUR
Custom 5’ UTR Reporter Lentiviral Vector Subcloning Luc size: 1.0 μg size: Subclone C098
600,00 € 600.0 EUR
Custom 5’ UTR Reporter Lentiviral Vector Subcloning GFP size: 1.0 μg size: Subclone C098
600,00 € 600.0 EUR
Cultrex Reduced Growth Factor Basement Membrane Extract, Type R1, PathClear size: 1 mL
330,00 € 330.0 EUR
Cultrex RGF Basement Membrane Extract, Type 2,
631,00 € 631.0 EUR
Cultrex 3size:D Culture Matrix Laminin I 30mg
1.186,00 € 1186.0 EUR
CuAAC Cell Reaction Buffer Kit THPTA based size: 1 kit
451,00 € 451.0 EUR
Cu/ZnSOD | Cu/Zn superoxide dismutase
350,00 € 350.0 EUR
CsA elisa kit :: Canine Cyclosporine A ELISA Kit size: 96 Tests
952,00 € 952.0 EUR
CsA elisa kit :: Canine Cyclosporine A ELISA Kit size: 5 X 96 Tests
4.720,00 € 4720.0 EUR
Crystallography Sample Supports SSX24, 50 units
1.379,00 € 1379.0 EUR
Crystallography Sample Supports SSX22, 50 units
1.379,00 € 1379.0 EUR
Crystallography Sample Supports SSX21, 50 units
1.379,00 € 1379.0 EUR
Crystallography Sample Supports SSX1X50 units
1.379,00 € 1379.0 EUR
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provided both a filter and a template to use.